PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma68g00150.1
Common NameZOSMA_68G00150
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family TALE
Protein Properties Length: 301aa    MW: 34262.2 Da    PI: 6.8831
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma68g00150.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.17.3e-092482822155
                      HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
         Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                      + +yp+++++  LA+ +gL+++q+ +WF N+R ++
  Zosma68g00150.1 248 NWPYPTEADKITLAELTGLDQKQINNWFINQRKRH 282
                      569*****************************885 PP

2ELK37.16.5e-13202223122
              ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                      ++K+ LlrKYsgyL+sL+qEFs
  Zosma68g00150.1 202 DIKEKLLRKYSGYLSSLRQEFS 223
                      58*******************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012559.7E-1967111IPR005540KNOX1
PfamPF037901.1E-1969108IPR005540KNOX1
SMARTSM012569.7E-21117168IPR005541KNOX2
PfamPF037912.4E-20123166IPR005541KNOX2
PfamPF037893.6E-10202223IPR005539ELK domain
PROSITE profilePS5121311.121202222IPR005539ELK domain
SMARTSM011888.2E-7202223IPR005539ELK domain
PROSITE profilePS5007112.536222285IPR001356Homeobox domain
SuperFamilySSF466891.41E-19223297IPR009057Homeodomain-like
SMARTSM003891.5E-13224289IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.1E-27227287IPR009057Homeodomain-like
CDDcd000861.88E-12234286No hitNo description
PfamPF059204.3E-17242281IPR008422Homeobox KN domain
PROSITE patternPS000270260283IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0009736Biological Processcytokinin-activated signaling pathway
GO:0010094Biological Processspecification of carpel identity
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MEDGTSTYGH GVQYQQHNSS ASSIHHHHHH PYVDDDLQAL ISRIPPLPPH NPSSSSSSYA  60
SSTTDTYSMK ARITAHPRYL RLLDAYIDCQ KVGAPPEIVS LLDEIRREHS TSNRAPISGH  120
QFADPELDLF MEAYCDVLTK YKADLTRPFD EATSFFSNME LQLSDLFKTA PSIGSSSDNA  180
QAGCDDEGLN GGEICCRDND RDIKEKLLRK YSGYLSSLRQ EFSKKKKKGK LPKEARQTLL  240
DWWNVHYNWP YPTEADKITL AELTGLDQKQ INNWFINQRK RHWKPSETMQ YAVMGRPYYG  300
*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010248543.11e-100PREDICTED: homeobox protein knotted-1-like 6
SwissprotQ84JS68e-91KNAT6_ARATH; Homeobox protein knotted-1-like 6
TrEMBLA0A0K9NS520.0A0A0K9NS52_Z
STRINGVIT_01s0127g00210.t011e-95(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP16983892
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23380.13e-88KNOTTED1-like homeobox gene 6